PDB entry 1ceu

View 1ceu on RCSB PDB site
Description: nmr structure of the (1-51) n-terminal domain of the hiv-1 regulatory protein
Class: Viral protein
Keywords: REGULATORY PROTEIN, HELICAL DOMAIN, AMPHIPATICITY, Viral protein
Deposited on 1999-03-10, released 2000-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hiv-1 regulatory protein n-terminal domain vpr)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ceua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ceuA (A:)
    meqapedqgpqrepyndwtlelleelkneavrhfpriwlhslgqhiyetyg