PDB entry 1cer

View 1cer on RCSB PDB site
Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution
Class: oxidoreductase (aldehyde(d)-nad(a))
Keywords: glycolysis, oxidoreductase, nad
Deposited on 1995-11-11, released 1996-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 1996-03-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMUS AQUATICUS
    Gene: THERMUS AQUATICUS GAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cera1, d1cera2
  • Chain 'B':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMUS AQUATICUS
    Gene: THERMUS AQUATICUS GAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cerb1, d1cerb2
  • Chain 'C':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMUS AQUATICUS
    Gene: THERMUS AQUATICUS GAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cerc1, d1cerc2
  • Chain 'D':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMUS AQUATICUS
    Gene: THERMUS AQUATICUS GAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cerd1, d1cerd2
  • Chain 'O':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMUS AQUATICUS
    Gene: THERMUS AQUATICUS GAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cero1, d1cero2
  • Chain 'P':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMUS AQUATICUS
    Gene: THERMUS AQUATICUS GAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cerp1, d1cerp2
  • Chain 'Q':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMUS AQUATICUS
    Gene: THERMUS AQUATICUS GAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cerq1, d1cerq2
  • Chain 'R':
    Compound: holo-d-glyceraldehyde-3-phosphate dehydrogenase
    Species: THERMUS AQUATICUS
    Gene: THERMUS AQUATICUS GAPDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1cerr1, d1cerr2
  • Heterogens: NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerA (A:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerB (B:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerC (C:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerD (D:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerO (O:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerP (P:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerQ (Q:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerR (R:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv