PDB entry 1cer

View 1cer on RCSB PDB site
Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution
Deposited on 1995-11-11, released 1996-03-08
The last revision prior to the SCOP 1.65 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    no info in PDB for this chain
  • Chain 'D':
    no info in PDB for this chain
  • Chain 'O':
    Domains in SCOP 1.65: d1cero1, d1cero2
  • Chain 'P':
    Domains in SCOP 1.65: d1cerp1, d1cerp2
  • Chain 'Q':
    Domains in SCOP 1.65: d1cerq1, d1cerq2
  • Chain 'R':
    Domains in SCOP 1.65: d1cerr1, d1cerr2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerO (O:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerP (P:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerQ (Q:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cerR (R:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv