PDB entry 1cen

View 1cen on RCSB PDB site
Description: cellulase (celc) mutant with glu 140 replaced by gln complexed with cellohexaose
Class: cellulose degradation
Keywords: glycosyl hydrolase, cellulase, family a/5 of glycosyl hydrolases, clostridium thermocellum, cellulose degradation
Deposited on 1995-12-04, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase celc
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07985 (0-End)
      • engineered (139)
      • conflict (155)
    Domains in SCOPe 2.07: d1cena_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cenA (A:)
    mvsfkaginlggwisqyqvfskehfdtfitekdietiaeagfdhvrlpfdypiiesddnv
    geykedglsyidrclewckkynlglvldmhhapgyrfqdfktstlfedpnqqkrfvdiwr
    flakryinerehiafellnqvvepdstrwnklmlecikaireidstmwlyiggnnynspd
    elknladidddyivynfhfynpfffthqkahwsesamaynrtvkypgqyegieefvknnp
    kysfmmelnnlklnkellrkdlkpaiefrekkkcklycgefgviaiadlesrikwhedyi
    slleeydiggavwnykkmdfeiynedrkpvsqelvnilarrkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cenA (A:)
    mvsfkaginlggwisqyqvfskehfdtfitekdietiaeagfdhvrlpfdypiiesddnv
    geykedglsyidrclewckkynlglvldmhhapgytstlfedpnqqkrfvdiwrflakry
    inerehiafellnqvvepdstrwnklmlecikaireidstmwlyiggnnynspdelknla
    didddyivynfhfynpfffthqkahwsesamaynrtvkypgqyegieefvknnpkysfmm
    elnnlklnkellrkdlkpaiefrekkkcklycgefgviaiadlesrikwhedyislleey
    diggavwnykkmdfeiynedrkpvsqelvnilar