PDB entry 1cem

View 1cem on RCSB PDB site
Description: endoglucanase a (cela) catalytic core, residues 33-395
Deposited on 1995-12-04, released 1997-01-11
The last revision prior to the SCOP 1.57 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.162
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1cem__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cem_ (-)
    agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
    vsegmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
    adedialalifadkqwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
    psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
    ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
    nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
    sdl