PDB entry 1cem

View 1cem on RCSB PDB site
Description: endoglucanase a (cela) catalytic core, residues 33-395
Class: glycosyltransferase
Keywords: glycosyl hydrolase, glycosyltransferase, cellulase, family d/8 of glycosyl hydrolases, clostridium thermocellum
Deposited on 1995-12-04, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.162
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase cela (1,4-beta-d-glucan-glucanohydrolase)
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: CELA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04955 (0-362)
      • conflict (134)
    Domains in SCOPe 2.07: d1cema_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cemA (A:)
    agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
    vsegmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
    adedialalifadkqwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
    psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
    ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
    nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
    sdl