PDB entry 1cei

View 1cei on RCSB PDB site
Description: structure determination of the colicin e7 immunity protein (imme7) that binds specifically to the DNAse-type colicin e7 and inhibits its bacteriocidal activity
Class: antibacterial protein
Keywords: immunity protein, antibacterial protein
Deposited on 1996-03-19, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e7 immunity protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ceia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ceiA (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqgkpgfkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ceiA (A:)
    lknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnrd
    dspegivkeikewraangkpgfkqg