PDB entry 1ceh

View 1ceh on RCSB PDB site
Description: structure and function of the catalytic site mutant asp99asn of phospholipase a2: absence of conserved structural water
Deposited on 1994-11-16, released 1995-02-07
The last revision prior to the SCOP 1.71 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1ceh__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ceh_ (-)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncnrnaaicfskvpynkehknldk
  knc