PDB entry 1ceh

View 1ceh on RCSB PDB site
Description: structure and function of the catalytic site mutant asp99asn of phospholipase a2: absence of conserved structural water
Class: hydrolase (carboxylic ester)
Keywords: hydrolase (carboxylic ester)
Deposited on 1994-11-16, released 1995-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • conflict (98)
  Domains in SCOPe 2.08: d1ceha_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cehA (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncnrnaaicfskvpynkehknldk
  knc