PDB entry 1cee

View 1cee on RCSB PDB site
Description: solution structure of cdc42 in complex with the gtpase binding domain of wasp
Class: Structural protein Regulation
Keywords: cdc42 actin regulator gtpase and the gtpase binding domain of its effector wasp
Deposited on 1999-03-08, released 1999-06-30
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding rho-like protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ceea_
  • Chain 'B':
    Compound: wiskott-aldrich syndrome protein wasp
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GCP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ceeA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalep
    

  • Chain 'B':
    No sequence available.