PDB entry 1cec

View 1cec on RCSB PDB site
Description: a common protein fold and similar active site in two distinct families of beta-glycanases
Class: hydrolase (glycosyl)
Keywords: glycosyl hydrolase, cellulase, family a/5 of cellulases/glycosyl hydrolases, clostridium thermocellum, endoglucanase c, hydrolase (glycosyl)
Deposited on 1995-06-07, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.168
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase celc
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: MC1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07985
      • conflict (155)
    Domains in SCOPe 2.07: d1ceca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cecA (A:)
    mvsfkaginlggwisqyqvfskehfdtfitekdietiaeagfdhvrlpfdypiiesddnv
    geykedglsyidrclewckkynlglvldmhhapgyrfqdfktstlfedpnqqkrfvdiwr
    flakryinerehiafellnevvepdstrwnklmlecikaireidstmwlyiggnnynspd
    elknladidddyivynfhfynpfffthqkahwsesamaynrtvkypgqyegieefvknnp
    kysfmmelnnlklnkellrkdlkpaiefrekkkcklycgefgviaiadlesrikwhedyi
    slleeydiggavwnykkmdfeiynedrkpvsqelvnilarrkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cecA (A:)
    vsfkaginlggwisqyqvfskehfdtfitekdietiaeagfdhvrlpfdypiiesddnvg
    eykedglsyidrclewckkynlglvldmhhapgstlfedpnqqkrfvdiwrflakryine
    rehiafellnevvepdstrwnklmlecikaireidstmwlyiggnnynspdelknladid
    ddyivynfhfynpfffthqkahwsesamaynrtvkypgqyegieefvknnpkysfmmeln
    nlklnkellrkdlkpaiefrekkkcklycgefgviaiadlesrikwhedyislleeydig
    gavwnykkmdfeiynedrkpvsqelvnilar