PDB entry 1cea

View 1cea on RCSB PDB site
Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with eaca (epsilon-aminocaproic acid)
Class: serine protease
Keywords: serine protease
Deposited on 1995-12-03, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ceaa_
  • Chain 'B':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ceab_
  • Heterogens: ACA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ceaA (A:)
    lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp
    qgpwcyttdpekrydycdileceeecmh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ceaA (A:)
    ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
    pwcyttdpekrydycdilec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ceaB (B:)
    lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp
    qgpwcyttdpekrydycdileceeecmh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ceaB (B:)
    ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
    pwcyttdpekrydycdilec