PDB entry 1ce8

View 1ce8 on RCSB PDB site
Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp
Class: ligase imp
Keywords: imp, allosteric ligand, ligase imp
Deposited on 1999-03-18, released 1999-07-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (carbamoyl-phosphate synthase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (0-1072)
      • sequence conflict (45)
      • sequence conflict8 (45)
    Domains in SCOPe 2.04: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6
  • Chain 'B':
    Compound: protein (carbamoyl-phosphate synthase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F1 (1-379)
      • sequence conflict (182)
      • sequence conflict8 (182)
    Domains in SCOPe 2.04: d1ce8b1, d1ce8b2
  • Chain 'C':
    Compound: protein (carbamoyl-phosphate synthase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (0-1072)
      • sequence conflict (45)
      • sequence conflict8 (45)
    Domains in SCOPe 2.04: d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6
  • Chain 'D':
    Compound: protein (carbamoyl-phosphate synthase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F1 (1-379)
      • sequence conflict (182)
      • sequence conflict8 (182)
    Domains in SCOPe 2.04: d1ce8d1, d1ce8d2
  • Chain 'E':
    Compound: protein (carbamoyl-phosphate synthase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (0-1072)
      • sequence conflict (45)
      • sequence conflict8 (45)
    Domains in SCOPe 2.04: d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6
  • Chain 'F':
    Compound: protein (carbamoyl-phosphate synthase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F1 (1-379)
      • sequence conflict (182)
      • sequence conflict8 (182)
    Domains in SCOPe 2.04: d1ce8f1, d1ce8f2
  • Chain 'G':
    Compound: protein (carbamoyl-phosphate synthase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00968 (0-1072)
      • sequence conflict (45)
      • sequence conflict8 (45)
    Domains in SCOPe 2.04: d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6
  • Chain 'H':
    Compound: protein (carbamoyl-phosphate synthase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F1 (1-379)
      • sequence conflict (182)
      • sequence conflict8 (182)
    Domains in SCOPe 2.04: d1ce8h1, d1ce8h2
  • Heterogens: MN, K, CL, PO4, ADP, ORN, IMP, NET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ce8A (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ce8A (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ce8B (B:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspgp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ce8B (B:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ce8C (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ce8C (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ce8D (D:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspgp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ce8D (D:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ce8E (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ce8E (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ce8F (F:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspgp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ce8F (F:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspgph
    daaplfdhfielieqyrkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ce8G (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ce8G (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpamei
    vydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacs
    lpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvsk
    atgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstg
    evmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldath
    gtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsalq
    ykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ce8H (H:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspgp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ce8H (H:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspgph
    daaplfdhfielieqyrkt