PDB entry 1ce7

View 1ce7 on RCSB PDB site
Description: mistletoe lectin I from viscum album
Class: ribosome
Keywords: ribosome-inactivating protein type II, ribosome
Deposited on 1999-03-18, released 2000-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.251
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribosome-inactivating protein type II)
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CE7 (0-240)
    Domains in SCOPe 2.07: d1ce7a_
  • Chain 'B':
    Compound: protein (ribosome-inactivating protein type II)
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ce7b1, d1ce7b2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ce7A (A:)
    yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns
    ggdgitvaidvtnlyvvayqagsqsyflsgpggrhgftgttrsslpfngsypdleqyggq
    rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas
    flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ce7B (B:)
    csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
    lttygytagvyvmifdcatavgeatvwqiwgngtiinprsnlvlaassgikgttltvqtl
    dytlgqgwlagndtaprevtiygfndlcmesgggsvtvetcssgkadkwalygdgsirpe
    qnqaqcltsggdsvagvnivscsgaasgqrwvftnegailnlknglamdvanpgggriii
    ypatgkpnqmwlpvf