PDB entry 1ce4

View 1ce4 on RCSB PDB site
Description: conformational model for the consensus v3 loop of the envelope protein gp120 of hiv-1
Class: Viral protein
Keywords: AMPHIPATHIC HELIX, HIV INFECTION, Viral protein
Deposited on 1999-03-15, released 1999-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (v3 loop of hiv-1 envelope protein)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20871 (0-34)
      • substition (4)
    Domains in SCOPe 2.07: d1ce4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ce4A (A:)
    ctrpnnntrksihigpgrafyttgeiigdirqahc