PDB entry 1ce3

View 1ce3 on RCSB PDB site
Description: putative ancestral protein encoded by a single sequence repeat of the multidomain proteinase inhibitor from nicotiana alata
Class: protease inhibitor
Keywords: protease inhibitor, circular permutation, nicotiana alata
Deposited on 1999-03-14, released 1999-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (api)
    Species: Nicotiana alata [TaxId:4087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ce3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ce3A (A:)
    mkactlncdpriaygvcprseekkndrictnccagtkgckyfsddgtfvceges