PDB entry 1ce1

View 1ce1 on RCSB PDB site
Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen
Class: immune system
Keywords: therapeutic, antibody, cd52, immune system
Deposited on 1999-03-12, released 1999-06-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (campath-1h:heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S79307 (0-219)
    Domains in SCOPe 2.05: d1ce1h1, d1ce1h2
  • Chain 'L':
    Compound: protein (campath-1h:light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S79311 (0-210)
    Domains in SCOPe 2.05: d1ce1l1, d1ce1l2
  • Chain 'P':
    Compound: protein (peptide antigen)
    Database cross-references and differences (RAF-indexed):
    • PDB 1CE1 (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ce1H (H:)
qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ce1L (L:)
diqmtqspsslsasvgdrvtitckasqnidkylnwyqqkpgkapklliyntnnlqtgvps
rfsgsgsgtdftftisslqpediatyyclqhisrprtfgqgtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnr

  • Chain 'P':
    No sequence available.