PDB entry 1ce1

View 1ce1 on RCSB PDB site
Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen
Class: antibody
Keywords: therapeutic, antibody, cd52
Deposited on 1999-03-12, released 1999-06-25
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (campath-1h:heavy chain)
    Species: ESCHERICHIA COLI
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB S79307 (0-219)
    Domains in SCOP 1.75: d1ce1h1, d1ce1h2
  • Chain 'L':
    Compound: protein (campath-1h:light chain)
    Species: ESCHERICHIA COLI
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB S79311 (0-210)
    Domains in SCOP 1.75: d1ce1l1, d1ce1l2
  • Chain 'P':
    Compound: protein (peptide antigen)
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ce1H (H:)
    qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
    eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ce1L (L:)
    diqmtqspsslsasvgdrvtitckasqnidkylnwyqqkpgkapklliyntnnlqtgvps
    rfsgsgsgtdftftisslqpediatyyclqhisrprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'P':
    No sequence available.