PDB entry 1cdz

View 1cdz on RCSB PDB site
Description: brct domain from DNA-repair protein xrcc1
Class: DNA binding protein
Keywords: brct, brca1, xrcc1, protein-protein interaction, DNA binding protein
Deposited on 1999-03-04, released 2000-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.224
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA-repair protein xrcc1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cdza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cdzA (A:)
elpdffqgkhfflygefpgderrkliryvtafngeledymsdrvqfvitaqewdpsfeea
lmdnpslafvrprwiyscnekqkllphqlygvvpqa