PDB entry 1cdy

View 1cdy on RCSB PDB site
Description: structure of T-cell surface glycoprotein cd4 mutant with gly 47 replaced by ser
Class: T-cell surface glycoprotein
Keywords: immunoglobulin fold, transmembrane, glycoprotein, T-cell, MHC, lipoprotein, T-cell surface glycoprotein
Deposited on 1996-11-11, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: T-cell surface glycoprotein cd4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01730 (0-177)
    • engineered (46)
  Domains in SCOPe 2.08: d1cdya1, d1cdya2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cdyA (A:)
  kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkspsklndradsrrs
  lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
  ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvla