PDB entry 1cdw

View 1cdw on RCSB PDB site
Description: human tbp core domain complexed with DNA
Class: transcription/DNA
Keywords: transcription initiation, DNA binding, complex (transcription factor/DNA), transcription/DNA complex
Deposited on 1996-04-11, released 1996-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (tata binding protein (tbp))
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20226 (0-178)
    • conflict (70)
  Domains in SCOPe 2.06: d1cdwa1, d1cdwa2
• Chain 'B':
  Compound: DNA (5'-d(*cp*tp*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*cp*tp*g)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*cp*ap*gp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*cp*ap*g)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cdwA (A:)
  sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
  mvctgakseensrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlthq
  qfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.