PDB entry 1cdw

View 1cdw on RCSB PDB site
Description: human tbp core domain complexed with dna
Deposited on 1996-04-11, released 1996-12-23
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdwA (A:)
    sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
    mvctgakseensrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlthq
    qfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk