PDB entry 1cdv

View 1cdv on RCSB PDB site
Description: on cytochrome $c=3= folding
Deposited on 1982-01-19, released 1982-04-15
The last revision was dated 1984-01-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1cdv_ (-)
apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkenyqkcatagchdnmdkkdk
sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs

  • Chain 'p':
    No sequence available.