PDB entry 1cdu

View 1cdu on RCSB PDB site
Description: structure of t-cell surface glycoprotein cd4 mutant with phe 43 replaced by val
Deposited on 1996-11-11, released 1997-04-01
The last revision prior to the SCOP 1.57 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.152
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cdu_ (-)
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsvltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvla