PDB entry 1cdt

View 1cdt on RCSB PDB site
Description: cardiotoxin v4/II from naja mossambica mossambica: the refined crystal structure
Class: cytotoxin
Keywords: cytotoxin
Deposited on 1990-05-17, released 1991-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cardiotoxin vii4
    Species: Naja mossambica [TaxId:8644]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1cdta_
  • Chain 'B':
    Compound: cardiotoxin vii4
    Species: Naja mossambica [TaxId:8644]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1cdtb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdtA (A:)
    lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdtB (B:)
    lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn