PDB entry 1cdt

View 1cdt on RCSB PDB site
Description: cardiotoxin v4/ii from naja mossambica mossambica: the refined crystal structure
Deposited on 1990-05-17, released 1991-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cdta_
  • Chain 'B':
    Domains in SCOP 1.55: d1cdtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cdtA (A:)
lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cdtB (B:)
lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn