PDB entry 1cds

View 1cds on RCSB PDB site
Description: structure of a soluble, glycosylated form of the human complement regulatory protein cd59
Class: complement regulatory protein
Keywords: complement regulatory protein
Deposited on 1994-06-01, released 1994-09-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd59
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1cdsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdsA (A:)
    lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
    yycckkdlcnfneqlen