PDB entry 1cdr

View 1cdr on RCSB PDB site
Description: structure of a soluble, glycosylated form of the human complement regulatory protein cd59
Deposited on 1994-06-01, released 1994-09-30
The last revision prior to the SCOP 1.67 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1cdr__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cdr_ (-)
  lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
  yycckkdlcnfneqlen