PDB entry 1cdo

View 1cdo on RCSB PDB site
Description: alcohol dehydrogenase (e.c.1.1.1.1) (ee isozyme) complexed with nicotinamide adenine dinucleotide (nad), and zinc
Class: oxidoreductase (ch-oh(d)-nad(a))
Keywords: oxidoreductase, oxidoreductase (ch-oh(d)-nad(a))
Deposited on 1995-09-29, released 1996-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Gadus callarias [TaxId:8053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cdoa1, d1cdoa2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Gadus callarias [TaxId:8053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cdob1, d1cdob2
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdoA (A:)
    atvgkvikckaavaweankplvieeievdvphaneirikiiatgvchtdlyhlfegkhkd
    gfpvvlghegagivesvgpgvtefqpgekviplfisqcgecrfcqspktnqcvkgwanes
    pdvmspketrftckgrkvlqflgtstfsqytvvnqiavakidpsapldtvcllgcgvstg
    fgaavntakvepgstcavfglgavglaavmgchsagakriiavdlnpdkfekakvfgatd
    fvnpndhsepisqvlskmtnggvdfslecvgnvgvmrnalesclkgwgvsvlvgwtdlhd
    vatrpiqliagrtwkgsmfggfkgkdgvpkmvkayldkkvkldefithrmplesvndaid
    lmkhgkcirtvlsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdoB (B:)
    atvgkvikckaavaweankplvieeievdvphaneirikiiatgvchtdlyhlfegkhkd
    gfpvvlghegagivesvgpgvtefqpgekviplfisqcgecrfcqspktnqcvkgwanes
    pdvmspketrftckgrkvlqflgtstfsqytvvnqiavakidpsapldtvcllgcgvstg
    fgaavntakvepgstcavfglgavglaavmgchsagakriiavdlnpdkfekakvfgatd
    fvnpndhsepisqvlskmtnggvdfslecvgnvgvmrnalesclkgwgvsvlvgwtdlhd
    vatrpiqliagrtwkgsmfggfkgkdgvpkmvkayldkkvkldefithrmplesvndaid
    lmkhgkcirtvlsl