PDB entry 1cdo

View 1cdo on RCSB PDB site
Description: alcohol dehydrogenase (e.c.1.1.1.1) (ee isozyme) complexed with nicotinamide adenine dinucleotide (nad), and zinc
Deposited on 1995-09-29, released 1996-03-08
The last revision prior to the SCOP 1.69 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.177
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdoA (A:)
    atvgkvikckaavaweankplvieeievdvphaneirikiiatgvchtdlyhlfegkhkd
    gfpvvlghegagivesvgpgvtefqpgekviplfisqcgecrfcqspktnqcvkgwanes
    pdvmspketrftckgrkvlqflgtstfsqytvvnqiavakidpsapldtvcllgcgvstg
    fgaavntakvepgstcavfglgavglaavmgchsagakriiavdlnpdkfekakvfgatd
    fvnpndhsepisqvlskmtnggvdfslecvgnvgvmrnalesclkgwgvsvlvgwtdlhd
    vatrpiqliagrtwkgsmfggfkgkdgvpkmvkayldkkvkldefithrmplesvndaid
    lmkhgkcirtvlsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdoB (B:)
    atvgkvikckaavaweankplvieeievdvphaneirikiiatgvchtdlyhlfegkhkd
    gfpvvlghegagivesvgpgvtefqpgekviplfisqcgecrfcqspktnqcvkgwanes
    pdvmspketrftckgrkvlqflgtstfsqytvvnqiavakidpsapldtvcllgcgvstg
    fgaavntakvepgstcavfglgavglaavmgchsagakriiavdlnpdkfekakvfgatd
    fvnpndhsepisqvlskmtnggvdfslecvgnvgvmrnalesclkgwgvsvlvgwtdlhd
    vatrpiqliagrtwkgsmfggfkgkdgvpkmvkayldkkvkldefithrmplesvndaid
    lmkhgkcirtvlsl