PDB entry 1cdn

View 1cdn on RCSB PDB site
Description: solution structure of (cd2+)1-calbindin d9k reveals details of the stepwise structural changes along the apo--> (ca2+)ii1--> (ca2+)i,ii2 binding pathway
Deposited on 1995-08-04, released 1995-11-14
The last revision prior to the SCOP 1.61 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1cdn__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cdn_ (-)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
  vsfeefqvlvkkisq