PDB entry 1cdn

View 1cdn on RCSB PDB site
Description: Solution structure of (CD2+)1-calbindin D9K reveals details of the stepwise structural changes along the apo--> (CA2+)II1--> (CA2+)I,II2 binding pathway
Class: calcium-binding protein
Keywords: ef-hand, calcium-binding protein
Deposited on 1995-08-04, released 1995-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calbindin d9k
  Species: Bos taurus [TaxId:9913]
  Gene: ICABP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02633 (1-75)
    • engineered (43)
  Domains in SCOPe 2.08: d1cdna_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1cdnA (A:)
  mkspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdg
  evsfeefqvlvkkisq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1cdnA (A:)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
  vsfeefqvlvkkisq