PDB entry 1cdi

View 1cdi on RCSB PDB site
Description: structures of an hiv and MHC binding fragment from human cd4 as refined in two crystal lattices
Class: T-cell surface glycoprotein
Keywords: T-cell surface glycoprotein
Deposited on 1994-01-26, released 1994-04-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.183
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t cell surface glycoprotein cd4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01730 (0-178)
      • conflict (0)
    Domains in SCOPe 2.01: d1cdia1, d1cdia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdiA (A:)
    tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
    slwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltle
    sppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvla