PDB entry 1cdi

View 1cdi on RCSB PDB site
Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
Deposited on 1994-01-26, released 1994-04-30
The last revision prior to the SCOP 1.71 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.183
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdi_ (-)
    tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
    slwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltle
    sppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvla