PDB entry 1cdd

View 1cdd on RCSB PDB site
Description: structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase
Deposited on 1992-05-15, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cdda_
  • Chain 'B':
    Domains in SCOP 1.55: d1cddb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cddA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cddA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpgtsvhfvtdel
    dggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaawldgqrl
    ppqgyaade
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cddB (B:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cddB (B:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpgtsvhfvtdel
    dggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaawldgqrl
    ppqgyaade