PDB entry 1cdc

View 1cdc on RCSB PDB site
Description: cd2, n-terminal domain (1-99), truncated form
Deposited on 1995-05-23, released 1995-09-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: -1.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cdca_
  • Chain 'B':
    Domains in SCOP 1.57: d1cdcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdcA (A:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilangdl
    kiknltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdcB (B:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilangdl
    kiknltrddsgtynvtvystngtrildkaldlrile