PDB entry 1cdc

View 1cdc on RCSB PDB site
Description: cd2, n-terminal domain (1-99), truncated form
Class: immune system protein, receptor
Keywords: misfolded, metastable, immune system protein, receptor
Deposited on 1995-05-23, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: -1.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cdca_
  • Chain 'B':
    Compound: cd2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cdcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cdcA (A:)
    rdsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilan
    gdlkiknltrddsgtynvtvystngtrildkaldlrile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cdcA (A:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilangdl
    kiknltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cdcB (B:)
    rdsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilan
    gdlkiknltrddsgtynvtvystngtrildkaldlrile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cdcB (B:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilangdl
    kiknltrddsgtynvtvystngtrildkaldlrile