PDB entry 1cdb

View 1cdb on RCSB PDB site
Description: structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2
Class: t lymphocyte adhesion glycoprotein
Keywords: t lymphocyte adhesion glycoprotein
Deposited on 1993-09-15, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd2
    Species: Homo sapiens [TaxId:9606]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cdba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cdbA (A:)
    keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
    klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer