PDB entry 1cd9

View 1cd9 on RCSB PDB site
Description: 2:2 complex of g-csf with its receptor
Deposited on 1999-03-08, released 2000-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-08, with a file datestamp of 2000-03-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd9A (A:)
    gpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplss
    cpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmee
    lgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cd9B (B:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldig
    pdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglh
    qapvytlqmrcirsslpgfwspwspglqlrptm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd9B (B:)
    agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
    akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldiq
    pgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhqapvytl
    qmrcirsslpgfwspwspglqlrptm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd9C (C:)
    asslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscp
    sqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelg
    mapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cd9D (D:)
    gyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcva
    kkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldigp
    dvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhq
    apvytlqmrcirsslpgfwspwspglqlrptm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd9D (D:)
    gyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcva
    kkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvvkleppmlqaldqpg
    clwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfelcglhqapvytlqm
    rcirsslpgfwspwspglqlrptm