PDB entry 1cd3

View 1cd3 on RCSB PDB site
Description: procapsid of bacteriophage phix174
Deposited on 1999-03-05, released 1999-04-01
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.275
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.55: d1cd31_
  • Chain '2':
    Domains in SCOP 1.55: d1cd32_
  • Chain '3':
    Domains in SCOP 1.55: d1cd33_
  • Chain '4':
    Domains in SCOP 1.55: d1cd34_
  • Chain 'F':
    Domains in SCOP 1.55: d1cd3f_
  • Chain 'G':
    Domains in SCOP 1.55: d1cd3g_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd31 (1:)
    eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
    vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
    rvragntdvltdaeenvrqklra
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd32 (2:)
    eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
    vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
    rvragntdvltdaee
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd33 (3:)
    teqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtld
    fvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaft
    lrvragntdvltdaeenvrq
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd34 (4:)
    qsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldfv
    gyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftlr
    vragntdvltdaeenvrqklraegvm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd3F (F:)
    sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
    dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
    khlfqgylniynnyfkapwmpdrteanpnelnqddarfgfrcchlkniwtaplppetels
    rqmttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrs
    nlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiq
    ylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvsp
    ayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttr
    dsimts
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd3G (G:)
    mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
    qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
    ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk