PDB entry 1cd3

View 1cd3 on RCSB PDB site
Description: procapsid of bacteriophage phix174
Class: virus
Keywords: COMPLEX (VIRUS CAPSID PROTEINS), BACTERIOPHAGE, PROCAPSID, SCAFFOLDING PROTEIN, CHAPERONE, Icosahedral virus, Virus
Deposited on 1999-03-05, released 1999-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: protein (scaffolding protein gpd)
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cd31_
  • Chain '2':
    Compound: protein (scaffolding protein gpd)
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cd32_
  • Chain '3':
    Compound: protein (scaffolding protein gpd)
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cd33_
  • Chain '4':
    Compound: protein (scaffolding protein gpd)
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cd34_
  • Chain 'B':
    Compound: protein (scaffolding protein gpb)
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: protein (capsid protein gpf)
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03641 (0-425)
      • conflict (215)
    Domains in SCOPe 2.07: d1cd3f_
  • Chain 'G':
    Compound: protein (spike protein gpg)
    Species: Enterobacteria phage phiX174 [TaxId:10847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cd3g_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1cd31 (1:)
    msqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvy
    gtldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaael
    faftlrvragntdvltdaeenvrqklraegvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd31 (1:)
    eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
    vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
    rvragntdvltdaeenvrqklra
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1cd32 (2:)
    msqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvy
    gtldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaael
    faftlrvragntdvltdaeenvrqklraegvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd32 (2:)
    eqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldf
    vgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftl
    rvragntdvltdaee
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1cd33 (3:)
    msqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvy
    gtldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaael
    faftlrvragntdvltdaeenvrqklraegvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd33 (3:)
    teqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtld
    fvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaft
    lrvragntdvltdaeenvrq
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1cd34 (4:)
    msqvteqsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvy
    gtldfvgyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaael
    faftlrvragntdvltdaeenvrqklraegvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd34 (4:)
    qsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldfv
    gyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftlr
    vragntdvltdaeenvrqklraegvm
    

  • Chain 'B':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd3F (F:)
    sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
    dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
    khlfqgylniynnyfkapwmpdrteanpnelnqddarfgfrcchlkniwtaplppetels
    rqmttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrs
    nlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiq
    ylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvsp
    ayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttr
    dsimts
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd3G (G:)
    mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
    qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
    ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk