PDB entry 1cd2

View 1cd2 on RCSB PDB site
Description: ligand induced conformational changes in the crystal structures of pneumocystis carinii dihydrofolate reductase complexes with folate and nadp+
Class: oxidoreductase
Keywords: oxidoreductase, one-carbon metabolism
Deposited on 1999-03-05, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cd2a_
  • Heterogens: NAP, FOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd2A (A:)
    mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
    twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
    fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
    vgtkvphgkinedgfdyefemwtrdl