PDB entry 1cd2

View 1cd2 on RCSB PDB site
Description: ligand induced conformational changes in the crystal structures of pneumocystis carinii dihydrofolate reductase complexes with folate and nadp+
Class: oxidoreductase
Keywords: oxidoreductase, one-carbon metabolism
Deposited on 1999-03-05, released 2000-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Pneumocystis carinii [TaxId:4754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16184 (0-205)
  Domains in SCOPe 2.08: d1cd2a_
• Heterogens: NAP, FOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cd2A (A:)
  mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
  twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
  fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
  vgtkvphgkinedgfdyefemwtrdl