PDB entry 1cd0

View 1cd0 on RCSB PDB site
Description: structure of human lamda-6 light chain dimer jto
Class: immune system
Keywords: immunoglobulin, bence-jones protein, lamda-6, immune system
Deposited on 1999-03-05, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (jto, a variable domain from lambda-6 type immunoglobulin light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06317 (0-110)
      • conflict (4)
      • conflict (25)
      • conflict (29)
      • conflict (45)
      • conflict (63)
      • conflict (66)
      • conflict (95-96)
      • conflict (98)
      • conflict (105)
    Domains in SCOPe 2.07: d1cd0a_
  • Chain 'B':
    Compound: protein (jto, a variable domain from lambda-6 type immunoglobulin light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06317 (0-End)
      • conflict (4)
      • conflict (25)
      • conflict (29)
      • conflict (45)
      • conflict (63)
      • conflict (66)
      • conflict (95-96)
      • conflict (98)
      • conflict (105)
    Domains in SCOPe 2.07: d1cd0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cd0A (A:)
    nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
    drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cd0B (B:)
    nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
    drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cd0B (B:)
    nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
    drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvl