PDB entry 1ccz

View 1ccz on RCSB PDB site
Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution
Class: glycoprotein
Keywords: cd58, lfa-3, glycoprotein
Deposited on 1999-03-02, released 1999-04-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cd58)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19256 (0-93)
  Domains in SCOPe 2.05: d1ccza1, d1ccza2
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cczA (A:)
  fsqqiygvvygnvtfhvpsnvplkevlwkkqkdkvaelensefrafssfknrvyldtvsg
  sltiynltssdedeyemespnitdtmkfflyvlemvskpmiywecsnatltcevlegtdv
  elklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe