PDB entry 1ccz

View 1ccz on RCSB PDB site
Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution
Class: glycoprotein
Keywords: cd58, lfa-3, crystal structure
Deposited on 1999-03-02, released 1999-04-05
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cd58)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ccza1, d1ccza2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cczA (A:)
    fsqqiygvvygnvtfhvpsnvplkevlwkkqkdkvaelensefrafssfknrvyldtvsg
    sltiynltssdedeyemespnitdtmkfflyvlemvskpmiywecsnatltcevlegtdv
    elklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe