PDB entry 1ccy

View 1ccy on RCSB PDB site
Description: crystallographic structure of rhodospirillum molischianum ferricytochrome $c(prime) at 2.5 angstroms resolution
Deposited on 1981-08-31, released 1982-02-03
The last revision was dated 1986-01-21, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ccyA (A:)
qqskpedllklrqglmqtlksqwvpiagfaagkadlpadaaqraenmamvaklapigwak
gtealpngetkpeafgsksaeflegwkalatestklaaaakagpdalkaqaaatgkvcka
cheefkqd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1ccyB (B:)
qqskpedllklrqglmqtlksqwvpiagfaagkadlpadaaqraenmamvaklapigwak
gtealpngetkpeafgsksaeflegwkalatestklaaaakagpdalkaqaaatgkvcka
cheefkqd