PDB entry 1ccw

View 1ccw on RCSB PDB site
Description: structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium
Class: isomerase
Keywords: GLUTAMATE MUTASE, COENZYME B12, RADICAL REACTION, TIM-BARREL, ROSSMAN-FOLD, isomerase
Deposited on 1999-03-01, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.137
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutamate mutase)
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80078 (0-136)
      • conflict (44)
      • conflict (59)
    Domains in SCOPe 2.07: d1ccwa_
  • Chain 'B':
    Compound: protein (glutamate mutase)
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80077 (0-482)
      • conflict (129)
    Domains in SCOPe 2.07: d1ccwb_
  • Chain 'C':
    Compound: protein (glutamate mutase)
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80078 (0-136)
      • conflict (44)
      • conflict (59)
    Domains in SCOPe 2.07: d1ccwc_
  • Chain 'D':
    Compound: protein (glutamate mutase)
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80077 (0-482)
      • conflict (129)
    Domains in SCOPe 2.07: d1ccwd_
  • Heterogens: CNC, TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccwA (A:)
    mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqelfikaaietkadailv
    sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
    tppevgiadlkkdlnie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccwB (B:)
    melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
    tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
    llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
    yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
    aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
    eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
    mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
    vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
    rpe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccwC (C:)
    mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqelfikaaietkadailv
    sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
    tppevgiadlkkdlnie
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccwD (D:)
    melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
    tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
    llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
    yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
    aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
    eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
    mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
    vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
    rpe