PDB entry 1ccv

View 1ccv on RCSB PDB site
Description: nmr solution structure of apis mellifera chymotrypsin inhibitor (amci).
Class: hydrolase inhibitor
Keywords: protein inhibitor, hemolymph, apis mellifera, canonical inhibitor, hydrolase inhibitor
Deposited on 1999-03-02, released 1999-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsin inhibitor
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ccva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccvA (A:)
    eecgpnevfntcgsacaptcaqpktrictmqcrigcqcqegflrngegacvlpenc