PDB entry 1ccr

View 1ccr on RCSB PDB site
Description: structure of rice ferricytochrome c at 2.0 angstroms resolution
Deposited on 1983-03-14, released 1983-04-21
The last revision prior to the SCOP 1.57 freeze date was dated 1987-04-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1ccr__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ccr_ (-)
  asfseappgnpkagekifktkcaqchtvdkgaghkqgpnlnglfgrqsgttpgysystad
  knmaviweentlydyllnpkkyipgtkmvfpglkkpqeradlisylkeats